Name: Tesamorelin
Sequence: YADAIFTNSYRKVLGQLSARKLLQDIANLQGLLFELSSLK
Peptide Length: 44‑amino acids
CAS Number: 218949‑48‑5
Molecular Formula: C₂₂₁H₃₆₆N₇₂O₆₇S
Molecular Weight: ≈ 5134.7–5135.9 g/mol

COA (certificate of analysis) provided: tesamorelin_coa_99.25%

Purity: 99.25% HPLC

Product Video:

Tesamorelin is a synthetic analogue of Growth Hormone–Releasing Hormone (GHRH). It is engineered to bind to and activate the GHRH receptor in the pituitary gland, which triggers pulsatile growth hormone (GH) release.
Below is a structured breakdown of its biological actions in research contexts.

1. Stimulates Growth Hormone Secretion
Tesamorelin mimics natural GHRH and activates the GHRH receptor, leading to:

increased GH pulse amplitude

increased downstream IGF‑1 production

preservation of natural GH pulsatility (unlike direct GH administration)

This makes it a valuable tool for studying the GH/IGF‑1 axis.

2. Influences Visceral Fat Metabolism (Research Context)
Tesamorelin is widely used in studies exploring:

visceral adipose tissue (VAT) reduction

lipid metabolism

metabolic regulation

Its GH‑mediated effects on lipolysis make it relevant in metabolic and endocrine research.

3. N‑Terminal Modification for Stability
Tesamorelin includes a 3‑hexenoyl modification on the N‑terminal tyrosine. This modification:

increases peptide stability

enhances receptor affinity

prolongs biological activity

This is why Tesamorelin behaves differently from native GHRH (1‑44).

4. Research Applications
Tesamorelin is used in studies involving:

GH/IGF‑1 signalling

metabolic disorders

visceral adiposity

endocrine regulation

aging‑related GH decline

Legal and Safety Information;
Quantum Peptides products are provided exclusively for laboratory research and educational use.
They are not approved for human or veterinary applications.
These materials are not intended to diagnose, treat, cure, or prevent any medical condition.
All use must adhere to applicable laws and regulatory requirements.

“The photo is for illustration purposes only and includes as much product information as possible. Bottle labels wrap around the container and may vary slightly in design & between batches as part of our anti‑counterfeiting measures.”